IL-9 (Interleukin-9), Mouse
Interleukin 9, also known as IL-9, is a pleiotropic cytokine (cell signalling molecule) belonging to the group of interleukins. IL-9 is produced by variety of cells like mast cells, NKT cells, Th2, Th17, Treg, ILC2, and Th9 cells in different amounts. Among them, Th9 cells are regarded as the major CD4+ T cells that produce IL-9.
Sequence:
QRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPC
NQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP with polyhistidine tag at the N-terminus
UnitProt ID:
P15247
Source:
Escherichia coli
Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.
Activity:
Measure by its ability to induce proliferation in MO7e cells. The ED50 for this effect is <0.2 ng/mL. The specific activity of recombinant mouse IL-9 is > 5 x 106 IU/mg.
Purity:
>98% as determined by SDS-PAGE analysis.
Form:
Lyophilized
Storage Buffer:
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.
Shipping Conditions:
Blue ice
QRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPC
NQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP with polyhistidine tag at the N-terminus
UnitProt ID:
P15247
Source:
Escherichia coli
Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.
Activity:
Measure by its ability to induce proliferation in MO7e cells. The ED50 for this effect is <0.2 ng/mL. The specific activity of recombinant mouse IL-9 is > 5 x 106 IU/mg.
Purity:
>98% as determined by SDS-PAGE analysis.
Form:
Lyophilized
Storage Buffer:
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.
Shipping Conditions:
Blue ice